Lineage for d1s1ua1 (1s1u A:430-539)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2123752Family c.55.3.1: Ribonuclease H [53099] (5 protein domains)
  6. 2123803Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 2123813Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2123886Domain d1s1ua1: 1s1u A:430-539 [105208]
    Other proteins in same PDB: d1s1ua2, d1s1ub1
    complexed with nvp; mutant

Details for d1s1ua1

PDB Entry: 1s1u (more details), 3 Å

PDB Description: Crystal structure of L100I mutant HIV-1 reverse transcriptase in complex with nevirapine
PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1s1ua1:

Sequence, based on SEQRES records: (download)

>d1s1ua1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Sequence, based on observed residues (ATOM records): (download)

>d1s1ua1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvpah

SCOPe Domain Coordinates for d1s1ua1:

Click to download the PDB-style file with coordinates for d1s1ua1.
(The format of our PDB-style files is described here.)

Timeline for d1s1ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s1ua2
View in 3D
Domains from other chains:
(mouse over for more information)
d1s1ub1