SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1s1mb1 (1s1m B:287-545)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104319Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 protein domains)
    contains a catalytic Cys-His-Glu triad
  6. 2104372Protein CTP synthase PyrG, C-terminal domain [110481] (2 species)
  7. 2104373Species Escherichia coli [TaxId:562] [110482] (1 PDB entry)
    Uniprot P08398
  8. 2104375Domain d1s1mb1: 1s1m B:287-545 [105203]
    Other proteins in same PDB: d1s1ma2, d1s1mb2
    complexed with iod, mg, mpd, so4

Details for d1s1mb1

PDB Entry: 1s1m (more details), 2.3 Å

PDB Description: Crystal Structure of E. Coli CTP Synthetase
PDB Compounds: (B:) CTP synthase

SCOPe Domain Sequences for d1s1mb1:

Sequence, based on SEQRES records: (download)

>d1s1mb1 c.23.16.1 (B:287-545) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]}
vsevtigmvgkyielpdayksviealkhgglknrvsvniklidsqdvetrgveilkglda
ilvpggfgyrgvegmittarfarennipylgiclgmqvalidyarhvanmenanstefvp
dckypvvalitewrdengnvevrseksdlggtmrlgaqqcqlvddslvrqlynaptiver
hrhryevnnmllkqiedaglrvagrsgddqlveiievpnhpwfvacqfhpeftstprdgh
plfagfvkaasefqkrqak

Sequence, based on observed residues (ATOM records): (download)

>d1s1mb1 c.23.16.1 (B:287-545) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]}
vsevtigmvgkyielpdayksviealkhgglknrvsvniklidsqdvetrgveilkglda
ilvpggfgyrgvegmittarfarennipylgiclgmqvalidyarhvanmenanstefvp
dckypvvalitewrdengnvevtmrlgaqqcqlvddslvrqlynaptiverhrhryevnn
mllkqiedaglrvagrsgddqlveiievpnhpwfvacqfhpeftstprdghplfagfvka
asefqkrqak

SCOPe Domain Coordinates for d1s1mb1:

Click to download the PDB-style file with coordinates for d1s1mb1.
(The format of our PDB-style files is described here.)

Timeline for d1s1mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s1mb2