Lineage for d1s1ma1 (1s1m A:287-544)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104319Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 protein domains)
    contains a catalytic Cys-His-Glu triad
  6. 2104372Protein CTP synthase PyrG, C-terminal domain [110481] (2 species)
  7. 2104373Species Escherichia coli [TaxId:562] [110482] (1 PDB entry)
    Uniprot P08398
  8. 2104374Domain d1s1ma1: 1s1m A:287-544 [105201]
    Other proteins in same PDB: d1s1ma2, d1s1mb2
    complexed with iod, mg, mpd, so4

Details for d1s1ma1

PDB Entry: 1s1m (more details), 2.3 Å

PDB Description: Crystal Structure of E. Coli CTP Synthetase
PDB Compounds: (A:) CTP synthase

SCOPe Domain Sequences for d1s1ma1:

Sequence, based on SEQRES records: (download)

>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]}
vsevtigmvgkyielpdayksviealkhgglknrvsvniklidsqdvetrgveilkglda
ilvpggfgyrgvegmittarfarennipylgiclgmqvalidyarhvanmenanstefvp
dckypvvalitewrdengnvevrseksdlggtmrlgaqqcqlvddslvrqlynaptiver
hrhryevnnmllkqiedaglrvagrsgddqlveiievpnhpwfvacqfhpeftstprdgh
plfagfvkaasefqkrqa

Sequence, based on observed residues (ATOM records): (download)

>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]}
vsevtigmvgkyielpdayksviealkhgglknrvsvniklidsqdvetrgveilkglda
ilvpggfgyrgvegmittarfarennipylgiclgmqvalidyarhvanmenanstefvp
dckypvvalitewrdengnvetmrlgaqqcqlvddslvrqlynaptiverhrhryevnnm
llkqiedaglrvagrsgddqlveiievpnhpwfvacqfhpeftstprdghplfagfvkaa
sefqkrqa

SCOPe Domain Coordinates for d1s1ma1:

Click to download the PDB-style file with coordinates for d1s1ma1.
(The format of our PDB-style files is described here.)

Timeline for d1s1ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s1ma2