Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [267689] (2 PDB entries) |
Domain d1s1iy_: 1s1i Y: [105199] MQ NA # low resolution complex structure 60S subunit; the 40S subunit is in 1S1H protein/RNA complex protein/RNA complex |
PDB Entry: 1s1i (more details), 11.7 Å
SCOPe Domain Sequences for d1s1iy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1iy_ i.1.1.1 (Y:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gkgtpsfgkrhnkshtlcnrcgrrsfhvqkktcsscgypaaktrsynwgaka
Timeline for d1s1iy_:
View in 3D Domains from other chains: (mouse over for more information) d1s1i0_, d1s1i9_, d1s1ia_, d1s1ib_, d1s1ic_, d1s1id_, d1s1ie_, d1s1if_, d1s1ig_, d1s1ih_, d1s1ii_, d1s1ij_, d1s1ik_, d1s1il_, d1s1im_, d1s1in_, d1s1io_, d1s1ip_, d1s1iq_, d1s1ir_, d1s1is_, d1s1it_, d1s1iu_, d1s1iv_, d1s1iw_, d1s1ix_, d1s1iz_ |