Lineage for d1s1iw_ (1s1i W:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3043338Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)
  7. 3043339Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [267689] (2 PDB entries)
  8. 3043380Domain d1s1iw_: 1s1i W: [105197]
    MQ NA # low resolution complex structure
    60S subunit; the 40S subunit is in 1S1H
    protein/RNA complex
    protein/RNA complex

Details for d1s1iw_

PDB Entry: 1s1i (more details), 11.7 Å

PDB Description: Structure of the ribosomal 80S-eEF2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 A cryo-EM map. This file, 1S1I, Contains 60S subunit. The 40S Ribosomal Subunit Is In File 1S1H.
PDB Compounds: (W:) 60S Ribosomal protein L31

SCOPe Domain Sequences for d1s1iw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1iw_ i.1.1.1 (W:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dvvtreytinlhkrlhgvsfkkrapravkeikkfaklhmgtddvrlapelnqaiwkrgvk
gveyrlrlrisrkrneee

SCOPe Domain Coordinates for d1s1iw_:

Click to download the PDB-style file with coordinates for d1s1iw_.
(The format of our PDB-style files is described here.)

Timeline for d1s1iw_: