Lineage for d1s1ir_ (1s1i R:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111483] (2 PDB entries)
  8. 526365Domain d1s1ir_: 1s1i R: [105192]

Details for d1s1ir_

PDB Entry: 1s1i (more details)

PDB Description: Structure of the ribosomal 80S-eEF2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 A cryo-EM map. This file, 1S1I, Contains 60S subunit. The 40S Ribosomal Subunit Is In File 1S1H.

SCOP Domain Sequences for d1s1ir_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ir_ i.1.1.1 (R:) 70S ribosome functional complex {Baker's yeast (Saccharomyces cerevisiae)}
qgtkfrislglpvgaimncadnsgarnlyiiavkgsgsrlnrlpaaslgdmvmatvkkgk
pelrkkvmpaivvrqakswrrrdgvflyfednagvianpkgemkgsaitgpvgkecadlw
prvasnsgvvv

SCOP Domain Coordinates for d1s1ir_:

Click to download the PDB-style file with coordinates for d1s1ir_.
(The format of our PDB-style files is described here.)

Timeline for d1s1ir_: