| Class i: Low resolution protein structures [58117] (24 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111483] (2 PDB entries) |
| Domain d1s1ie_: 1s1i E: [105179] |
PDB Entry: 1s1i (more details)
SCOP Domain Sequences for d1s1ie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1ie_ i.1.1.1 (E:) 70S ribosome functional complex {Baker's yeast (Saccharomyces cerevisiae)}
ayssrfqtpfrrrregktdyyqrkrlvtqhkakyntpkyrlvvrftnkdiicqiisstit
gdvvlaaayshelprygithgltnwaaayatglliarrtlqrlgldetykgveevegeye
lteavedgprpfkvfldiglqrtttgarvfgalkgasdgglyvphsenrfpgwdfeteei
dpellrsyifgghvsqymeeladddeerfselfkgyladdid
Timeline for d1s1ie_:
View in 3DDomains from other chains: (mouse over for more information) d1s1i0_, d1s1i3_, d1s1i4_, d1s1i9_, d1s1ia_, d1s1ib_, d1s1ic_, d1s1id_, d1s1if_, d1s1ig_, d1s1ih_, d1s1ii_, d1s1ij_, d1s1ik_, d1s1il_, d1s1im_, d1s1in_, d1s1io_, d1s1ip_, d1s1iq_, d1s1ir_, d1s1is_, d1s1it_, d1s1iu_, d1s1iv_, d1s1iw_, d1s1ix_, d1s1iy_, d1s1iz_ |