Lineage for d1s1ib_ (1s1i B:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 753714Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111483] (2 PDB entries)
  8. 753734Domain d1s1ib_: 1s1i B: [105176]

Details for d1s1ib_

PDB Entry: 1s1i (more details)

PDB Description: Structure of the ribosomal 80S-eEF2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 A cryo-EM map. This file, 1S1I, Contains 60S subunit. The 40S Ribosomal Subunit Is In File 1S1H.
PDB Compounds: (B:) 60S ribosomal protein L2

SCOP Domain Sequences for d1s1ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ib_ i.1.1.1 (B:) 70S ribosome functional complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grvirnqrkgagsiftshtrlrqgaaklrtldyaerhgyirgivkqivhdsgrgaplakv
vfrdpykyrlreeifianegvhtgqfiyagkkaslnvgnvlplgsvpegtivsnveekpg
drgalarasgnyviiighnpdenktrvrlpsgakkvissdargvigviagggrvdkpllk
agrafhkyrlkrnswpktrgvamnpvdhphgggnhqhigkastisrgavsgqkagliaar
rtgl

SCOP Domain Coordinates for d1s1ib_:

Click to download the PDB-style file with coordinates for d1s1ib_.
(The format of our PDB-style files is described here.)

Timeline for d1s1ib_: