Lineage for d1s1ht_ (1s1h T:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627049Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111483] (2 PDB entries)
  8. 627066Domain d1s1ht_: 1s1h T: [105170]
    MQ NA # low resolution complex structure
    40S subunit; the 60S subunit is in 1S1I

Details for d1s1ht_

PDB Entry: 1s1h (more details)

PDB Description: Structure of the ribosomal 80S-eEF2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 A cryo-EM map. This file, 1S1H, Contains 40S subunit. The 60S Ribosomal Subunit Is In File 1S1I.

SCOP Domain Sequences for d1s1ht_:

Sequence, based on SEQRES records: (download)

>d1s1ht_ i.1.1.1 (T:) 70S ribosome functional complex {Baker's yeast (Saccharomyces cerevisiae)}
aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrkd
eqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvt
dgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartv
esvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmd
rlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllek
leivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpad
danciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgk
kddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmk
fsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleicl
qdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevslaie
ngiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikds
vvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflladp
kiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftg
elrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Sequence, based on observed residues (ATOM records): (download)

>d1s1ht_ i.1.1.1 (T:) 70S ribosome functional complex {Baker's yeast (Saccharomyces cerevisiae)}
aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislyse
msdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqte
tvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgdv
qvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtnk
dtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkall
kvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlml
yvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgr
fvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknand
lpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkisppv
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqav
ggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqafpqmvfdhwst
lgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOP Domain Coordinates for d1s1ht_:

Click to download the PDB-style file with coordinates for d1s1ht_.
(The format of our PDB-style files is described here.)

Timeline for d1s1ht_: