Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [267689] (2 PDB entries) |
Domain d1s1hm_: 1s1h M: [105165] MQ NA # low resolution complex structure 40S subunit; the 60S subunit is in 1S1I protein/RNA complex protein/RNA complex |
PDB Entry: 1s1h (more details), 11.7 Å
SCOPe Domain Sequences for d1s1hm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1hm_ i.1.1.1 (M:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lrllntnvdgnikivyalttikgvgrrysnlvckkadvdlhkrageltqeelerivqimq npthykipawflnrqnditdgkdyhtlannvesklrddlerlkkirahrgirhfwglrvr gqhtkttgrrr
Timeline for d1s1hm_: