| Class i: Low resolution protein structures [58117] (26 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111483] (2 PDB entries) |
| Domain d1s1hk_: 1s1h K: [105163] |
PDB Entry: 1s1h (more details)
SCOP Domain Sequences for d1s1hk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1hk_ i.1.1.1 (K:) 70S ribosome functional complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dnsqvfgvariyasfndtfvhvtdlsgketiarvtggmkvkadrdesspyaamlaaqdva
akcrevgitavhvkiratggtrtktpgpggqaalralarsglrigriedvtpvpsdstrk
kggrr
Timeline for d1s1hk_: