SCOPe 2.08: Domain d1s13b_: 1s13 B:

Lineage for d1s13b_ (1s13 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
   Uniprot P09601

8. Domain d1s13b_: 1s13 B: [105153]
   complexed with 2fh

Details for d1s13b_

PDB Entry: 1s13, 2.29 Å

PDB Description: Human Heme Oxygenase Oxidatition of alpha- and gamma-meso-Phenylhemes

PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d1s13b_:

Sequence; same for both SEQRES and ATOM records:

>d1s13b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1s13b_:

• d1s13b_ first appeared in SCOP 1.69
  
• d1s13b_ appears in SCOPe 2.07