Lineage for d1s0ka2 (1s0k A:1-399)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (8 proteins) 
Protein Trypanosoma sialidase [82164] (2 species) Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89371] (11 PDB entries) 
Domain d1s0ka2: 1s0k A:1-399 [105151]
Other proteins in same PDB: d1s0ka1
Details for d1s0ka2
PDB Entry: 1s0k (more details), 1.6 Å
PDB Description: Trypanosoma cruzi trans-sialidase in complex with 2,3-difluorosialic acid (covalent intermediate)
SCOP Domain Sequences for d1s0ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0ka2 b.68.1.1 (A:1-399) Trypanosoma sialidase {Parasitic flagellate protozoan (Trypanosoma cruzi)}
lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdn
slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheins
nevyslvfarlvgelriiksvlqswknwdshlssictpa
SCOP Domain Coordinates for d1s0ka2:
Click to download the PDB-style file with coordinates for d1s0ka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s0ka2:
- d1s0ka2 is new in SCOP 1.69
- d1s0ka2 last appears in SCOP 1.71
View in 3D
