Lineage for d1s0ja1 (1s0j A:409-632)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390095Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 2390096Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 2390097Species Trypanosoma cruzi [TaxId:5693] [89271] (13 PDB entries)
    Uniprot Q26966
  8. 2390105Domain d1s0ja1: 1s0j A:409-632 [105148]
    Other proteins in same PDB: d1s0ja2
    complexed with mus

Details for d1s0ja1

PDB Entry: 1s0j (more details), 1.65 Å

PDB Description: trypanosoma cruzi trans-sialidase in complex with munana (michaelis complex)
PDB Compounds: (A:) Trans-sialidase

SCOPe Domain Sequences for d1s0ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0ja1 b.29.1.15 (A:409-632) Trypanosoma sialidase, C-terminal domain {Trypanosoma cruzi [TaxId: 5693]}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteah

SCOPe Domain Coordinates for d1s0ja1:

Click to download the PDB-style file with coordinates for d1s0ja1.
(The format of our PDB-style files is described here.)

Timeline for d1s0ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s0ja2