Lineage for d1s03h_ (1s03 H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217010Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2217011Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2217012Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2217013Protein Ribosomal protein S8 [56049] (4 species)
  7. 2217017Species Escherichia coli [TaxId:562] [111186] (9 PDB entries)
    Uniprot P02361
  8. 2217019Domain d1s03h_: 1s03 H: [105145]
    complexed with the spc operon mRNA
    protein/RNA complex; complexed with zn

Details for d1s03h_

PDB Entry: 1s03 (more details), 2.7 Å

PDB Description: The Structure of a Ribosomal Protein S8/spc Operon mRNA Complex
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1s03h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s03h_ d.140.1.1 (H:) Ribosomal protein S8 {Escherichia coli [TaxId: 562]}
qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl
kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg
eiicyva

SCOPe Domain Coordinates for d1s03h_:

Click to download the PDB-style file with coordinates for d1s03h_.
(The format of our PDB-style files is described here.)

Timeline for d1s03h_: