![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
![]() | Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) ![]() automatically mapped to Pfam PF00410 |
![]() | Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
![]() | Protein Ribosomal protein S8 [56049] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [111186] (9 PDB entries) Uniprot P02361 |
![]() | Domain d1s03g_: 1s03 G: [105144] complexed with the spc operon mRNA protein/RNA complex; complexed with zn |
PDB Entry: 1s03 (more details), 2.7 Å
SCOPe Domain Sequences for d1s03g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s03g_ d.140.1.1 (G:) Ribosomal protein S8 {Escherichia coli [TaxId: 562]} dpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltlk yfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgge iicyva
Timeline for d1s03g_: