Lineage for d1rzsa_ (1rzs A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537276Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 537317Protein cro p22 [109809] (1 species)
  7. 537318Species Bacteriophage p22 [TaxId:10754] [109810] (1 PDB entry)
  8. 537319Domain d1rzsa_: 1rzs A: [105139]

Details for d1rzsa_

PDB Entry: 1rzs (more details)

PDB Description: solution structure of p22 cro

SCOP Domain Sequences for d1rzsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzsa_ a.35.1.2 (A:) cro p22 {Bacteriophage p22}
mykkdvidhfgtqravakalgisdaavsqwkevipekdayrleivtagalkyqenayrqa
a

SCOP Domain Coordinates for d1rzsa_:

Click to download the PDB-style file with coordinates for d1rzsa_.
(The format of our PDB-style files is described here.)

Timeline for d1rzsa_: