![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families) ![]() |
![]() | Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
![]() | Protein cro p22 [109809] (1 species) |
![]() | Species Bacteriophage p22 [TaxId:10754] [109810] (1 PDB entry) |
![]() | Domain d1rzsa_: 1rzs A: [105139] |
PDB Entry: 1rzs (more details)
SCOP Domain Sequences for d1rzsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzsa_ a.35.1.2 (A:) cro p22 {Bacteriophage p22} mykkdvidhfgtqravakalgisdaavsqwkevipekdayrleivtagalkyqenayrqa a
Timeline for d1rzsa_: