Lineage for d1rzsa_ (1rzs A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993669Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1993670Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1993691Family a.35.1.2: Phage repressors [47419] (7 protein domains)
    consists of different sequence families of HTH repressors of phage origins
  6. 1993736Protein cro p22 [109809] (1 species)
  7. 1993737Species Bacteriophage p22 [TaxId:10754] [109810] (1 PDB entry)
    Uniprot P09964
  8. 1993738Domain d1rzsa_: 1rzs A: [105139]

Details for d1rzsa_

PDB Entry: 1rzs (more details)

PDB Description: Solution structure of P22 Cro
PDB Compounds: (A:) regulatory protein cro

SCOPe Domain Sequences for d1rzsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzsa_ a.35.1.2 (A:) cro p22 {Bacteriophage p22 [TaxId: 10754]}
mykkdvidhfgtqravakalgisdaavsqwkevipekdayrleivtagalkyqenayrqa
a

SCOPe Domain Coordinates for d1rzsa_:

Click to download the PDB-style file with coordinates for d1rzsa_.
(The format of our PDB-style files is described here.)

Timeline for d1rzsa_: