Lineage for d1rzmb_ (1rzm B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572455Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 572812Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 572813Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)
  7. 572886Species Thermotoga maritima [TaxId:243274] [110363] (1 PDB entry)
  8. 572888Domain d1rzmb_: 1rzm B: [105138]
    complexed with cd, e4p, pep

Details for d1rzmb_

PDB Entry: 1rzm (more details), 2.2 Å

PDB Description: Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHPS) from Thermotoga maritima complexed with Cd2+, PEP and E4P

SCOP Domain Sequences for d1rzmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzmb_ c.1.10.4 (B:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima}
mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
pepekalsdgkqsldfelfkelvqemkkladalgvkvn

SCOP Domain Coordinates for d1rzmb_:

Click to download the PDB-style file with coordinates for d1rzmb_.
(The format of our PDB-style files is described here.)

Timeline for d1rzmb_: