Lineage for d1rz6a2 (1rz6 A:167-322)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691549Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. 2691550Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. 2691567Species Pseudomonas nautica [TaxId:2743] [100993] (3 PDB entries)
    Uniprot P83787
  8. 2691571Domain d1rz6a2: 1rz6 A:167-322 [105136]
    complexed with cit, hec

Details for d1rz6a2

PDB Entry: 1rz6 (more details), 2.2 Å

PDB Description: di-haem cytochrome c peroxidase, form in
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1rz6a2:

Sequence, based on SEQRES records: (download)

>d1rz6a2 a.3.1.5 (A:167-322) Di-heme cytochrome c peroxidase {Pseudomonas nautica [TaxId: 2743]}
eapfdkylrgdtsalnesekeglalfmdrgctachsgvnlggqnyypfglvakpgaeilp
egdkgrfsvtetasdeyvfrasplrnieltapyfhsgavwsleeavavmgtaqlgtelnn
devksivaflktltgnvpevtypvlppstantpkpv

Sequence, based on observed residues (ATOM records): (download)

>d1rz6a2 a.3.1.5 (A:167-322) Di-heme cytochrome c peroxidase {Pseudomonas nautica [TaxId: 2743]}
eapfdkylrgdtsalnesekeglalfmdrgctachsgvnlggqnyypfglvakkgrfsvt
etasdeyvfrasplrnieltapyfhsgavwsleeavavmgtaqlgtelnndevksivafl
ktltgnvpevtypvlppstantpkpv

SCOPe Domain Coordinates for d1rz6a2:

Click to download the PDB-style file with coordinates for d1rz6a2.
(The format of our PDB-style files is described here.)

Timeline for d1rz6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rz6a1