Lineage for d1rz5a2 (1rz5 A:167-326)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980960Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. 1980961Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. 1980978Species Pseudomonas nautica [TaxId:2743] [100993] (3 PDB entries)
    Uniprot P83787
  8. 1980984Domain d1rz5a2: 1rz5 A:167-326 [105134]
    complexed with ca, hem

Details for d1rz5a2

PDB Entry: 1rz5 (more details), 2.4 Å

PDB Description: Di-haem Cytochrome c Peroxidase, Form OUT
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1rz5a2:

Sequence, based on SEQRES records: (download)

>d1rz5a2 a.3.1.5 (A:167-326) Di-heme cytochrome c peroxidase {Pseudomonas nautica [TaxId: 2743]}
eapfdkylrgdtsalnesekeglalfmdrgctachsgvnlggqnyypfglvakpgaeilp
egdkgrfsvtetasdeyvfrasplrnieltapyfhsgavwsleeavavmgtaqlgtelnn
devksivaflktltgnvpevtypvlppstantpkpvdmip

Sequence, based on observed residues (ATOM records): (download)

>d1rz5a2 a.3.1.5 (A:167-326) Di-heme cytochrome c peroxidase {Pseudomonas nautica [TaxId: 2743]}
eapfdkylrgdtsalnesekeglalfmdrgctachsgvnlggqnyypfglvakkgrfsvt
etasdeyvfrasplrnieltapyfhsgavwsleeavavmgtaqlgtelnndevksivafl
ktltgnvpevtypvlppstantpkpvdmip

SCOPe Domain Coordinates for d1rz5a2:

Click to download the PDB-style file with coordinates for d1rz5a2.
(The format of our PDB-style files is described here.)

Timeline for d1rz5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rz5a1