Lineage for d1rz5a1 (1rz5 A:1-166)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. Species Pseudomonas nautica [TaxId:2743] [100993] (3 PDB entries)
    Uniprot P83787
  8. Domain d1rz5a1: 1rz5 A:1-166 [105133]
    complexed with ca, hec

Details for d1rz5a1

PDB Entry: 1rz5 (more details), 2.4 Å

PDB Description: di-haem cytochrome c peroxidase, form out
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1rz5a1:

Sequence, based on SEQRES records: (download)

>d1rz5a1 a.3.1.5 (A:1-166) Di-heme cytochrome c peroxidase {Pseudomonas nautica [TaxId: 2743]}
dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
gddelptsighgwqkgprnsptvfnavfnaaqfwdgraadlaeqakgpvqagvemsstpd
rvvatlksmpeyierfedafpgqenpvtfdnmavaieayeatlitp

Sequence, based on observed residues (ATOM records): (download)

>d1rz5a1 a.3.1.5 (A:1-166) Di-heme cytochrome c peroxidase {Pseudomonas nautica [TaxId: 2743]}
dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
gddelptsighgwqkgprnsptvfnavfnaaqfwdgrakgpvqagvemsstpdrvvatlk
smpeyierfedafpgqenpvtfdnmavaieayeatlitp

SCOPe Domain Coordinates for d1rz5a1 are not available.

Timeline for d1rz5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rz5a2