Lineage for d1rz2a_ (1rz2 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471989Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 471990Superfamily b.100.1: Sortase [63817] (1 family) (S)
  5. 471991Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 471992Protein Hypothetical protein BA4783 [110281] (1 species)
  7. 471993Species Bacillus anthracis [TaxId:1392] [110282] (1 PDB entry)
  8. 471994Domain d1rz2a_: 1rz2 A: [105130]

Details for d1rz2a_

PDB Entry: 1rz2 (more details), 1.6 Å

PDB Description: 1.6A crystal structure of the protein BA4783/Q81L49 (similar to sortase B) from Bacillus anthracis.

SCOP Domain Sequences for d1rz2a_:

Sequence, based on SEQRES records: (download)

>d1rz2a_ b.100.1.1 (A:) Hypothetical protein BA4783 {Bacillus anthracis}
ifmdyyenrkvmaeaqniyekspmeeqsqdgevrkqfkalqqinqeivgwitmddtqiny
pivqakdndyylfrnykgedmragsifmdyrndvksqnrntilyghrmkdgsmfgslkkm
ldeeffmshrklyydtlfegydlevfsvyttttdfyyietdfssdteytsflekiqeksl
yktdttvtagdqivtlstcdyaldpeagrlvvhaklvkrq

Sequence, based on observed residues (ATOM records): (download)

>d1rz2a_ b.100.1.1 (A:) Hypothetical protein BA4783 {Bacillus anthracis}
ifmdyyenrkvmaeaqniyekspmeeqsqdgevrkqfkalqqinqeivgwitmddtqiny
pivqakdndyylfrnykgedmragsifmdyrndvksqnrntilyghrmkdgsmfgslkkm
ldeeffmshrklyydtlfegydlevfsvyttttdfyyietdfssdteytsflekiqeksl
yktdttvtagdqivtlstcdagrlvvhaklvkrq

SCOP Domain Coordinates for d1rz2a_:

Click to download the PDB-style file with coordinates for d1rz2a_.
(The format of our PDB-style files is described here.)

Timeline for d1rz2a_: