Lineage for d1rz2a_ (1rz2 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. Superfamily b.100.1: Sortase [63817] (2 families) (S)
  5. Family b.100.1.1: Sortase [63818] (3 proteins)
  6. Protein Hypothetical protein BA4783 [110281] (1 species)
  7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [110282] (3 PDB entries)
    Uniprot Q81L49
  8. Domain d1rz2a_: 1rz2 A: [105130]

Details for d1rz2a_

PDB Entry: 1rz2 (more details), 1.6 Å

PDB Description: 1.6A crystal structure of the protein BA4783/Q81L49 (similar to sortase B) from Bacillus anthracis.
PDB Compounds: (A:) conserved hypothetical protein BA4783

SCOPe Domain Sequences for d1rz2a_:

Sequence, based on SEQRES records: (download)

>d1rz2a_ b.100.1.1 (A:) Hypothetical protein BA4783 {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ifmdyyenrkvmaeaqniyekspmeeqsqdgevrkqfkalqqinqeivgwitmddtqiny
pivqakdndyylfrnykgedmragsifmdyrndvksqnrntilyghrmkdgsmfgslkkm
ldeeffmshrklyydtlfegydlevfsvyttttdfyyietdfssdteytsflekiqeksl
yktdttvtagdqivtlstcdyaldpeagrlvvhaklvkrq

Sequence, based on observed residues (ATOM records): (download)

>d1rz2a_ b.100.1.1 (A:) Hypothetical protein BA4783 {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ifmdyyenrkvmaeaqniyekspmeeqsqdgevrkqfkalqqinqeivgwitmddtqiny
pivqakdndyylfrnykgedmragsifmdyrndvksqnrntilyghrmkdgsmfgslkkm
ldeeffmshrklyydtlfegydlevfsvyttttdfyyietdfssdteytsflekiqeksl
yktdttvtagdqivtlstcdagrlvvhaklvkrq

SCOPe Domain Coordinates for d1rz2a_ are not available.

Timeline for d1rz2a_: