SCOP 1.69: Domain d1ryxa1: 1ryx A:1-334

Lineage for d1ryxa1 (1ryx A:1-334)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (3 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Ovotransferrin [53894] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [53896] (9 PDB entries)

8. Domain d1ryxa1: 1ryx A:1-334 [105128]

Details for d1ryxa1

PDB Entry: 1ryx, 3.5 Å

PDB Description: crystal structure of hen serum transferrin in apo- form

SCOP Domain Sequences for d1ryxa1:

Sequence; same for both SEQRES and ATOM records:

>d1ryxa1 c.94.1.2 (A:1-334) Ovotransferrin {Chicken (Gallus gallus)}
appksvirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisld
ggqafeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglg
rsagwnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpkt
kcarnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyk
tcnwarvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllf
kdsaimlkrvpslmdsqlylgfeyysaiqsmrkd

Timeline for d1ryxa1:

• d1ryxa1 is new in SCOP 1.69
  
• d1ryxa1 appears in SCOP 1.71
  
• d1ryxa1 appears in the current release, SCOPe 2.08