![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.3: ARID-like [46774] (1 family) ![]() contains extra helices at both N- and C-termini |
![]() | Family a.4.3.1: ARID domain [46775] (4 proteins) |
![]() | Protein SWI-SNF complex protein p270, SMARCF1 [109662] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109663] (1 PDB entry) |
![]() | Domain d1ryua_: 1ryu A: [105127] |
PDB Entry: 1ryu (more details)
SCOP Domain Sequences for d1ryua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryua_ a.4.3.1 (A:) SWI-SNF complex protein p270, SMARCF1 {Human (Homo sapiens)} sstttnekitklyelggeperkmwvdrylafteekamgmtnlpavgrkpldlyrlyvsvk eiggltqvnknkkwrelatnlnvgtsssaasslkkqyiqclyafeckiergedpppdifa
Timeline for d1ryua_: