Lineage for d1ryqa1 (1ryq A:3-61)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263789Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) (S)
  5. 2263836Family g.41.9.3: RpoE2-like [111454] (2 proteins)
    Pfam PF04035
  6. 2263837Protein putative DNA-directed RNA polymerase subunit E'' (RpoE2) [111455] (1 species)
  7. 2263838Species Pyrococcus furiosus [TaxId:2261] [111456] (1 PDB entry)
    Uniprot Q8U440
  8. 2263839Domain d1ryqa1: 1ryq A:3-61 [105126]
    Other proteins in same PDB: d1ryqa2
    Structural genomics target
    complexed with zn

Details for d1ryqa1

PDB Entry: 1ryq (more details), 1.38 Å

PDB Description: putative dna-directed rna polymerase, subunit e'' from pyrococcus furiosus pfu-263306-001
PDB Compounds: (A:) DNA-directed RNA polymerase, subunit e''

SCOPe Domain Sequences for d1ryqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryqa1 g.41.9.3 (A:3-61) putative DNA-directed RNA polymerase subunit E'' (RpoE2) {Pyrococcus furiosus [TaxId: 2261]}
ekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr

SCOPe Domain Coordinates for d1ryqa1:

Click to download the PDB-style file with coordinates for d1ryqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ryqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ryqa2