Lineage for d1ryqa_ (1ryq A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464791Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) (S)
  5. 1464829Family g.41.9.3: RpoE2-like [111454] (1 protein)
    Pfam PF04035
  6. 1464830Protein putative DNA-directed RNA polymerase subunit E'' (RpoE2) [111455] (1 species)
  7. 1464831Species Pyrococcus furiosus [TaxId:2261] [111456] (1 PDB entry)
    Uniprot Q8U440
  8. 1464832Domain d1ryqa_: 1ryq A: [105126]
    Structural genomics target
    complexed with zn

Details for d1ryqa_

PDB Entry: 1ryq (more details), 1.38 Å

PDB Description: putative dna-directed rna polymerase, subunit e'' from pyrococcus furiosus pfu-263306-001
PDB Compounds: (A:) DNA-directed RNA polymerase, subunit e''

SCOPe Domain Sequences for d1ryqa_:

Sequence, based on SEQRES records: (download)

>d1ryqa_ g.41.9.3 (A:) putative DNA-directed RNA polymerase subunit E'' (RpoE2) {Pyrococcus furiosus [TaxId: 2261]}
hhhhhgssekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpg
kyairvr

Sequence, based on observed residues (ATOM records): (download)

>d1ryqa_ g.41.9.3 (A:) putative DNA-directed RNA polymerase subunit E'' (RpoE2) {Pyrococcus furiosus [TaxId: 2261]}
hhhhhekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkya
irvr

SCOPe Domain Coordinates for d1ryqa_:

Click to download the PDB-style file with coordinates for d1ryqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ryqa_: