Lineage for d1ryqa_ (1ryq A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524485Superfamily g.41.9: RNA polymerase subunits [63393] (2 families) (S)
  5. 524493Family g.41.9.3: RpoE2-like (Pfam 04035) [111454] (1 protein)
  6. 524494Protein putative DNA-directed RNA polymerase subunit E'' (RpoE2) [111455] (1 species)
  7. 524495Species Pyrococcus furiosus [TaxId:186497] [111456] (1 PDB entry)
  8. 524496Domain d1ryqa_: 1ryq A: [105126]
    Structural genomics target

Details for d1ryqa_

PDB Entry: 1ryq (more details), 1.38 Å

PDB Description: putative dna-directed rna polymerase, subunit e'' from pyrococcus furiosus pfu-263306-001

SCOP Domain Sequences for d1ryqa_:

Sequence, based on SEQRES records: (download)

>d1ryqa_ g.41.9.3 (A:) putative DNA-directed RNA polymerase subunit E'' (RpoE2) {Pyrococcus furiosus}
hhhhhgssekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpg
kyairvr

Sequence, based on observed residues (ATOM records): (download)

>d1ryqa_ g.41.9.3 (A:) putative DNA-directed RNA polymerase subunit E'' (RpoE2) {Pyrococcus furiosus}
hhhhhekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkya
irvr

SCOP Domain Coordinates for d1ryqa_:

Click to download the PDB-style file with coordinates for d1ryqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ryqa_: