![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) ![]() |
![]() | Family g.41.9.3: RpoE2-like [111454] (2 proteins) Pfam PF04035 |
![]() | Protein putative DNA-directed RNA polymerase subunit E'' (RpoE2) [111455] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [111456] (1 PDB entry) Uniprot Q8U440 |
![]() | Domain d1ryqa1: 1ryq A:3-61 [105126] Other proteins in same PDB: d1ryqa2 Structural genomics target complexed with zn |
PDB Entry: 1ryq (more details), 1.38 Å
SCOPe Domain Sequences for d1ryqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryqa1 g.41.9.3 (A:3-61) putative DNA-directed RNA polymerase subunit E'' (RpoE2) {Pyrococcus furiosus [TaxId: 2261]} ekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr
Timeline for d1ryqa1: