Lineage for d1rylb_ (1ryl B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009494Fold d.276: Hypothetical protein yfbM [111068] (1 superfamily)
    beta-alpha(2)-beta-alpha(2)-beta(2)-alpha(n)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 21543
  4. 3009495Superfamily d.276.1: Hypothetical protein yfbM [111069] (1 family) (S)
    automatically mapped to Pfam PF08974
  5. 3009496Family d.276.1.1: Hypothetical protein yfbM [111070] (1 protein)
  6. 3009497Protein Hypothetical protein yfbM [111071] (1 species)
  7. 3009498Species Escherichia coli [TaxId:562] [111072] (1 PDB entry)
    Uniprot P76483
  8. 3009500Domain d1rylb_: 1ryl B: [105125]
    Structural genomics target

Details for d1rylb_

PDB Entry: 1ryl (more details), 1.6 Å

PDB Description: The Crystal Structure of a Protein of Unknown Function YfbM from Escherichia coli
PDB Compounds: (B:) Hypothetical protein yfbM

SCOPe Domain Sequences for d1rylb_:

Sequence, based on SEQRES records: (download)

>d1rylb_ d.276.1.1 (B:) Hypothetical protein yfbM {Escherichia coli [TaxId: 562]}
migyfaeidsekinqllestekplmdnihdtlsglrrldidkrwdflhfgltgtsafdpa
kndplsravlgehsledgidgflgltwnqelaatidrlesldrnelrkqfsikrlnemei
ypgvtfseelegqlfasimldmeklisayrrmlrqgnhaltviv

Sequence, based on observed residues (ATOM records): (download)

>d1rylb_ d.276.1.1 (B:) Hypothetical protein yfbM {Escherichia coli [TaxId: 562]}
migyfaeidsekinqlleihdtlsglrrldidkrwdflhfgltgtsafdpakndplsrav
lgehslflgltwnqelaatidrlesldrnelrkqfsikrlnemeiypgvtfseelegqlf
asimldmeklisayrrmlrqgnhaltviv

SCOPe Domain Coordinates for d1rylb_:

Click to download the PDB-style file with coordinates for d1rylb_.
(The format of our PDB-style files is described here.)

Timeline for d1rylb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ryla_