![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.276: Hypothetical protein yfbM [111068] (1 superfamily) beta-alpha(2)-beta-alpha(2)-beta(2)-alpha(n)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 21543 |
![]() | Superfamily d.276.1: Hypothetical protein yfbM [111069] (1 family) ![]() automatically mapped to Pfam PF08974 |
![]() | Family d.276.1.1: Hypothetical protein yfbM [111070] (1 protein) |
![]() | Protein Hypothetical protein yfbM [111071] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [111072] (1 PDB entry) Uniprot P76483 |
![]() | Domain d1rylb_: 1ryl B: [105125] Structural genomics target |
PDB Entry: 1ryl (more details), 1.6 Å
SCOPe Domain Sequences for d1rylb_:
Sequence, based on SEQRES records: (download)
>d1rylb_ d.276.1.1 (B:) Hypothetical protein yfbM {Escherichia coli [TaxId: 562]} migyfaeidsekinqllestekplmdnihdtlsglrrldidkrwdflhfgltgtsafdpa kndplsravlgehsledgidgflgltwnqelaatidrlesldrnelrkqfsikrlnemei ypgvtfseelegqlfasimldmeklisayrrmlrqgnhaltviv
>d1rylb_ d.276.1.1 (B:) Hypothetical protein yfbM {Escherichia coli [TaxId: 562]} migyfaeidsekinqlleihdtlsglrrldidkrwdflhfgltgtsafdpakndplsrav lgehslflgltwnqelaatidrlesldrnelrkqfsikrlnemeiypgvtfseelegqlf asimldmeklisayrrmlrqgnhaltviv
Timeline for d1rylb_: