Lineage for d1ryla_ (1ryl A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615329Fold d.276: Hypothetical protein yfbM [111068] (1 superfamily)
    beta-alpha(2)-beta-alpha(2)-beta(2)-alpha(n)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 21543
  4. 2615330Superfamily d.276.1: Hypothetical protein yfbM [111069] (1 family) (S)
    automatically mapped to Pfam PF08974
  5. 2615331Family d.276.1.1: Hypothetical protein yfbM [111070] (1 protein)
  6. 2615332Protein Hypothetical protein yfbM [111071] (1 species)
  7. 2615333Species Escherichia coli [TaxId:562] [111072] (1 PDB entry)
    Uniprot P76483
  8. 2615334Domain d1ryla_: 1ryl A: [105124]
    Structural genomics target

Details for d1ryla_

PDB Entry: 1ryl (more details), 1.6 Å

PDB Description: The Crystal Structure of a Protein of Unknown Function YfbM from Escherichia coli
PDB Compounds: (A:) Hypothetical protein yfbM

SCOPe Domain Sequences for d1ryla_:

Sequence, based on SEQRES records: (download)

>d1ryla_ d.276.1.1 (A:) Hypothetical protein yfbM {Escherichia coli [TaxId: 562]}
migyfaeidsekinqllestekplmdnihdtlsglrrldidkrwdflhfgltgtsafdpa
kndplsravlgehsledgidgflgltwnqelaatidrlesldrnelrkqfsikrlnemei
ypgvtfseelegqlfasimldmeklisayrrmlrqgnhaltviv

Sequence, based on observed residues (ATOM records): (download)

>d1ryla_ d.276.1.1 (A:) Hypothetical protein yfbM {Escherichia coli [TaxId: 562]}
migyfaeidsekinqllesmdnihdtlsglrrldidkrwdflhfgltgtsafdpakndpl
sravlgehsleddgflgltwnqelaatidrlesldrnelrkqfsikrlnemeiypgvtfs
eelegqlfasimldmeklisayrrmlrqgnhaltviv

SCOPe Domain Coordinates for d1ryla_:

Click to download the PDB-style file with coordinates for d1ryla_.
(The format of our PDB-style files is described here.)

Timeline for d1ryla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rylb_