SCOP 1.69: Domain d1ryla_: 1ryl A:

Lineage for d1ryla_ (1ryl A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.276: Hypothetical protein yfbM [111068] (1 superfamily)
   beta-alpha(2)-beta-alpha(2)-beta(2)-alpha(n)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 21543

4. Superfamily d.276.1: Hypothetical protein yfbM [111069] (1 family)

5. Family d.276.1.1: Hypothetical protein yfbM [111070] (1 protein)

6. Protein Hypothetical protein yfbM [111071] (1 species)

7. Species Escherichia coli [TaxId:562] [111072] (1 PDB entry)

8. Domain d1ryla_: 1ryl A: [105124]

Details for d1ryla_

PDB Entry: 1ryl, 1.6 Å

PDB Description: The Crystal Structure of a Protein of Unknown Function YfbM from Escherichia coli

SCOP Domain Sequences for d1ryla_:

Sequence, based on SEQRES records:

>d1ryla_ d.276.1.1 (A:) Hypothetical protein yfbM {Escherichia coli}
migyfaeidsekinqllestekplmdnihdtlsglrrldidkrwdflhfgltgtsafdpa
kndplsravlgehsledgidgflgltwnqelaatidrlesldrnelrkqfsikrlnemei
ypgvtfseelegqlfasimldmeklisayrrmlrqgnhaltviv

Sequence, based on observed residues (ATOM records):

>d1ryla_ d.276.1.1 (A:) Hypothetical protein yfbM {Escherichia coli}
migyfaeidsekinqllesmdnihdtlsglrrldidkrwdflhfgltgtsafdpakndpl
sravlgehsleddgflgltwnqelaatidrlesldrnelrkqfsikrlnemeiypgvtfs
eelegqlfasimldmeklisayrrmlrqgnhaltviv

Timeline for d1ryla_:

• d1ryla_ is new in SCOP 1.69
  
• d1ryla_ appears in SCOP 1.71
  
• d1ryla_ appears in the current release, SCOPe 2.08