Lineage for d1ryab_ (1rya B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2578301Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins)
  6. 2578302Protein GDP-mannose mannosyl hydrolase NudD [111133] (1 species)
  7. 2578303Species Escherichia coli [TaxId:562] [111134] (3 PDB entries)
    Uniprot P32056
  8. 2578305Domain d1ryab_: 1rya B: [105123]
    complexed with cl, gdp, mg, trs

Details for d1ryab_

PDB Entry: 1rya (more details), 1.3 Å

PDB Description: crystal structure of the e. coli gdp-mannose mannosyl hydrolase in complex with gdp and mg
PDB Compounds: (B:) GDP-mannose mannosyl hydrolase

SCOPe Domain Sequences for d1ryab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryab_ d.113.1.5 (B:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllp
deqhddyrwltsdallasdnvhansrayflaekrtgvpgl

SCOPe Domain Coordinates for d1ryab_:

Click to download the PDB-style file with coordinates for d1ryab_.
(The format of our PDB-style files is described here.)

Timeline for d1ryab_: