Lineage for d1ryab_ (1rya B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509941Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 509942Superfamily d.113.1: Nudix [55811] (5 families) (S)
  5. 510057Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (1 protein)
  6. 510058Protein GDP-mannose mannosyl hydrolase NudD [111133] (1 species)
  7. 510059Species Escherichia coli [TaxId:562] [111134] (1 PDB entry)
  8. 510061Domain d1ryab_: 1rya B: [105123]

Details for d1ryab_

PDB Entry: 1rya (more details), 1.3 Å

PDB Description: crystal structure of the e. coli gdp-mannose mannosyl hydrolase in complex with gdp and mg

SCOP Domain Sequences for d1ryab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryab_ d.113.1.5 (B:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli}
mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllp
deqhddyrwltsdallasdnvhansrayflaekrtgvpgl

SCOP Domain Coordinates for d1ryab_:

Click to download the PDB-style file with coordinates for d1ryab_.
(The format of our PDB-style files is described here.)

Timeline for d1ryab_: