SCOPe 2.08: Domain d1ryab_: 1rya B:

Lineage for d1ryab_ (1rya B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins)

6. Protein GDP-mannose mannosyl hydrolase NudD [111133] (1 species)

7. Species Escherichia coli [TaxId:562] [111134] (3 PDB entries)
   Uniprot P32056

8. Domain d1ryab_: 1rya B: [105123]
   complexed with cl, gdp, mg, trs

Details for d1ryab_

PDB Entry: 1rya, 1.3 Å

PDB Description: crystal structure of the e. coli gdp-mannose mannosyl hydrolase in complex with gdp and mg

PDB Compounds: (B:) GDP-mannose mannosyl hydrolase

SCOPe Domain Sequences for d1ryab_:

Sequence; same for both SEQRES and ATOM records:

>d1ryab_ d.113.1.5 (B:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllp
deqhddyrwltsdallasdnvhansrayflaekrtgvpgl

Timeline for d1ryab_:

• d1ryab_ first appeared in SCOP 1.69
  
• d1ryab_ appears in SCOPe 2.07