Lineage for d1ryaa_ (1rya A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211761Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins)
  6. 2211762Protein GDP-mannose mannosyl hydrolase NudD [111133] (1 species)
  7. 2211763Species Escherichia coli [TaxId:562] [111134] (3 PDB entries)
    Uniprot P32056
  8. 2211764Domain d1ryaa_: 1rya A: [105122]
    complexed with cl, gdp, mg, trs

Details for d1ryaa_

PDB Entry: 1rya (more details), 1.3 Å

PDB Description: crystal structure of the e. coli gdp-mannose mannosyl hydrolase in complex with gdp and mg
PDB Compounds: (A:) GDP-mannose mannosyl hydrolase

SCOPe Domain Sequences for d1ryaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllp
deqhddyrwltsdallasdnvhansrayflaekrtgvpgl

SCOPe Domain Coordinates for d1ryaa_:

Click to download the PDB-style file with coordinates for d1ryaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ryaa_: