Lineage for d1rxqc_ (1rxq C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450642Fold a.213: YfiT-like putative metal-dependent hydrolases [109853] (1 superfamily)
    # core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order
  4. 450643Superfamily a.213.1: YfiT-like putative metal-dependent hydrolases [109854] (1 family) (S)
    contains metal-binding site on the bundle surface surrounded by loops
  5. 450644Family a.213.1.1: YfiT-like putative metal-dependent hydrolases [109855] (1 protein)
    probably distantly related to the DinB family (Pfam 05163)
  6. 450645Protein YfiT [109856] (1 species)
  7. 450646Species Bacillus subtilis [TaxId:1423] [109857] (1 PDB entry)
  8. 450649Domain d1rxqc_: 1rxq C: [105120]

Details for d1rxqc_

PDB Entry: 1rxq (more details), 1.7 Å

PDB Description: YfiT from Bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology

SCOP Domain Sequences for d1rxqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxqc_ a.213.1.1 (C:) YfiT {Bacillus subtilis}
nlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwtvrqv
vhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelhgrwt
allrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws

SCOP Domain Coordinates for d1rxqc_:

Click to download the PDB-style file with coordinates for d1rxqc_.
(The format of our PDB-style files is described here.)

Timeline for d1rxqc_: