Lineage for d1rxqb_ (1rxq B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546180Fold a.213: YfiT-like putative metal-dependent hydrolases [109853] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order
  4. 546181Superfamily a.213.1: YfiT-like putative metal-dependent hydrolases [109854] (1 family) (S)
    contains metal-binding site on the bundle surface surrounded by loops
  5. 546182Family a.213.1.1: YfiT-like putative metal-dependent hydrolases [109855] (1 protein)
    probably distantly related to the DinB family (Pfam 05163)
  6. 546183Protein YfiT [109856] (1 species)
  7. 546184Species Bacillus subtilis [TaxId:1423] [109857] (1 PDB entry)
  8. 546186Domain d1rxqb_: 1rxq B: [105119]

Details for d1rxqb_

PDB Entry: 1rxq (more details), 1.7 Å

PDB Description: YfiT from Bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology

SCOP Domain Sequences for d1rxqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxqb_ a.213.1.1 (B:) YfiT {Bacillus subtilis}
vnlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwtvrq
vvhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelhgrw
tallrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws

SCOP Domain Coordinates for d1rxqb_:

Click to download the PDB-style file with coordinates for d1rxqb_.
(The format of our PDB-style files is described here.)

Timeline for d1rxqb_: