![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order |
![]() | Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families) ![]() contains metal-binding site on the bundle surface surrounded by loops |
![]() | Family a.213.1.1: YfiT-like putative metal-dependent hydrolases [109855] (1 protein) probably distantly related to the DinB family (Pfam PF05163) |
![]() | Protein YfiT [109856] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [109857] (1 PDB entry) Uniprot O31562 |
![]() | Domain d1rxqb_: 1rxq B: [105119] complexed with glu, ni |
PDB Entry: 1rxq (more details), 1.7 Å
SCOPe Domain Sequences for d1rxqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxqb_ a.213.1.1 (B:) YfiT {Bacillus subtilis [TaxId: 1423]} vnlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwtvrq vvhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelhgrw tallrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws
Timeline for d1rxqb_: