Lineage for d1rxqa_ (1rxq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737633Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order
  4. 2737634Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families) (S)
    contains metal-binding site on the bundle surface surrounded by loops
  5. 2737635Family a.213.1.1: YfiT-like putative metal-dependent hydrolases [109855] (1 protein)
    probably distantly related to the DinB family (Pfam PF05163)
  6. 2737636Protein YfiT [109856] (1 species)
  7. 2737637Species Bacillus subtilis [TaxId:1423] [109857] (1 PDB entry)
    Uniprot O31562
  8. 2737638Domain d1rxqa_: 1rxq A: [105118]
    complexed with glu, ni

Details for d1rxqa_

PDB Entry: 1rxq (more details), 1.7 Å

PDB Description: YfiT from Bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology
PDB Compounds: (A:) yfiT

SCOPe Domain Sequences for d1rxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxqa_ a.213.1.1 (A:) YfiT {Bacillus subtilis [TaxId: 1423]}
nlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwtvrqv
vhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelhgrwt
allrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws

SCOPe Domain Coordinates for d1rxqa_:

Click to download the PDB-style file with coordinates for d1rxqa_.
(The format of our PDB-style files is described here.)

Timeline for d1rxqa_: