Lineage for d1rw0b_ (1rw0 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005836Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets
  4. 3005837Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (3 families) (S)
  5. 3005846Family d.194.1.2: YfiH-like [111238] (5 proteins)
    Pfam PF02578; COG1496
  6. 3005853Protein Hypothetical protein yfiH [111243] (3 species)
  7. 3005856Species Salmonella typhi [TaxId:90370] [111244] (1 PDB entry)
    Uniprot Q8Z4J1
  8. 3005858Domain d1rw0b_: 1rw0 B: [105111]

Details for d1rw0b_

PDB Entry: 1rw0 (more details), 2 Å

PDB Description: crystal structure of protein yfih from salmonella enterica serovar typhi, pfam duf152
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1rw0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rw0b_ d.194.1.2 (B:) Hypothetical protein yfiH {Salmonella typhi [TaxId: 90370]}
mnalivpqwplpkgvaacsstriggvslspydslnlgahcgdnpehveenrkrlfaagnl
pskpvwleqvhgknvlrltgepyaskradasysntpgtvcavmtadclpvlfcnregtev
aaahagwrglcegvleetvtcfadkpeniiawlgpaigpaafevgpevrdaflakdaqad
saflphgekfladiyqlarqrlantgvehvyggdrctfsesetffsyrrdkttgrmasfi
wli

SCOPe Domain Coordinates for d1rw0b_:

Click to download the PDB-style file with coordinates for d1rw0b_.
(The format of our PDB-style files is described here.)

Timeline for d1rw0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rw0a_