Lineage for d1rv9a_ (1rv9 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 615693Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets
  4. 615694Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (2 families) (S)
  5. 615700Family d.194.1.2: YfiH-like [111238] (4 proteins)
    Pfam 02578; COG1496
  6. 615704Protein Hypothetical protein NMB0706 [111241] (1 species)
  7. 615705Species Neisseria meningitidis, serogroup B [TaxId:487] [111242] (1 PDB entry)
  8. 615706Domain d1rv9a_: 1rv9 A: [105105]
    complexed with so4

Details for d1rv9a_

PDB Entry: 1rv9 (more details), 1.53 Å

PDB Description: crystal structure of neisseria meningitidis protein nmb0706, pfam duf152

SCOP Domain Sequences for d1rv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv9a_ d.194.1.2 (A:) Hypothetical protein NMB0706 {Neisseria meningitidis, serogroup B}
knfltadwpapanvktlittrnggvsqgayqslnlgthvgdnpeavrrnreivqqqvglp
vaylnqihstvvvnaaealggtpdadasvddtgkvacavmtadclpvlfcdragtavaaa
hagwrglaggvlqntiaamkvppvemmaylgpaisadafevgqdvfdafctpmpeaataf
egigsgkfladlyalarlilkregvggvyggthctvlerdtffsyrrdgatgrmasliwl
dg

SCOP Domain Coordinates for d1rv9a_:

Click to download the PDB-style file with coordinates for d1rv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1rv9a_: