Lineage for d1rv9a_ (1rv9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005836Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets
  4. 3005837Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (3 families) (S)
  5. 3005846Family d.194.1.2: YfiH-like [111238] (5 proteins)
    Pfam PF02578; COG1496
  6. 3005850Protein Hypothetical protein NMB0706 [111241] (1 species)
  7. 3005851Species Neisseria meningitidis, serogroup B [TaxId:487] [111242] (1 PDB entry)
    Uniprot Q9K0A8
  8. 3005852Domain d1rv9a_: 1rv9 A: [105105]
    complexed with so4

Details for d1rv9a_

PDB Entry: 1rv9 (more details), 1.53 Å

PDB Description: crystal structure of neisseria meningitidis protein nmb0706, pfam duf152
PDB Compounds: (A:) conserved hypothetical protein NMB0706

SCOPe Domain Sequences for d1rv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv9a_ d.194.1.2 (A:) Hypothetical protein NMB0706 {Neisseria meningitidis, serogroup B [TaxId: 487]}
knfltadwpapanvktlittrnggvsqgayqslnlgthvgdnpeavrrnreivqqqvglp
vaylnqihstvvvnaaealggtpdadasvddtgkvacavmtadclpvlfcdragtavaaa
hagwrglaggvlqntiaamkvppvemmaylgpaisadafevgqdvfdafctpmpeaataf
egigsgkfladlyalarlilkregvggvyggthctvlerdtffsyrrdgatgrmasliwl
dg

SCOPe Domain Coordinates for d1rv9a_:

Click to download the PDB-style file with coordinates for d1rv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1rv9a_: