Lineage for d1rv4b_ (1rv4 B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490721Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 490722Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 491163Family c.67.1.4: GABA-aminotransferase-like [53417] (13 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 491291Protein Serine hydroxymethyltransferase [53429] (5 species)
  7. 491314Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53430] (6 PDB entries)
  8. 491320Domain d1rv4b_: 1rv4 B: [105104]

Details for d1rv4b_

PDB Entry: 1rv4 (more details), 2.95 Å

PDB Description: e75l mutant of rabbit cytosolic serine hydroxymethyltransferase

SCOP Domain Sequences for d1rv4b_:

Sequence, based on SEQRES records: (download)

>d1rv4b_ c.67.1.4 (B:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus)}
wssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasravlealgsclnnkys
lgypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgspanfavytalvep
hgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyidydrleenarlfh
pkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvvpspfehchvvttt
thktlrgcragmifyrrgvrsvdpktgkeilynleslinsavfpglqggphnhaiagvav
alkqamtpefkeyqrqvvancralsaalvelgykivtggsdnhlilvdlrskgtdggrae
kvleacsiacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkvahfihrgieltvq
iqddtgpratlkefkeklagdekhqravralrqevesfaalfplpglpgf

Sequence, based on observed residues (ATOM records): (download)

>d1rv4b_ c.67.1.4 (B:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus)}
wssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasravlealgsclnnkys
lgypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgspanfavytalvep
hgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyidydrleenarlfh
pkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvvpspfehchvvttt
thktlrgcragmifyrrgvrsvdkeilynleslinsavfpglqggphnhaiagvavalkq
amtpefkeyqrqvvancralsaalvelgykivtggsdnhlilvdlrskgtdggraekvle
acsiacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkvahfihrgieltvqiqdd
tgpratlkefkeklagdekhqravralrqevesfaalfplpglpgf

SCOP Domain Coordinates for d1rv4b_:

Click to download the PDB-style file with coordinates for d1rv4b_.
(The format of our PDB-style files is described here.)

Timeline for d1rv4b_: