Lineage for d1rv4a_ (1rv4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131911Protein Serine hydroxymethyltransferase [53429] (6 species)
  7. 2131975Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53430] (6 PDB entries)
    Uniprot P07511
  8. 2131980Domain d1rv4a_: 1rv4 A: [105103]
    complexed with plp, po4; mutant

Details for d1rv4a_

PDB Entry: 1rv4 (more details), 2.95 Å

PDB Description: e75l mutant of rabbit cytosolic serine hydroxymethyltransferase
PDB Compounds: (A:) Serine hydroxymethyltransferase, cytosolic

SCOPe Domain Sequences for d1rv4a_:

Sequence, based on SEQRES records: (download)

>d1rv4a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
wssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasravlealgsclnnkys
lgypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgspanfavytalvep
hgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyidydrleenarlfh
pkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvvpspfehchvvttt
thktlrgcragmifyrrgvrsvdpktgkeilynleslinsavfpglqggphnhaiagvav
alkqamtpefkeyqrqvvancralsaalvelgykivtggsdnhlilvdlrskgtdggrae
kvleacsiacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkvahfihrgieltvq
iqddtgpratlkefkeklagdekhqravralrqevesfaalfplpglpgf

Sequence, based on observed residues (ATOM records): (download)

>d1rv4a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
wssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasravlealgsclnnkys
lgypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgspanfavytalvep
hgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyidydrleenarlfh
pkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvvpspfehchvvttt
thktlrgcragmifyrrgvrseilynleslinsavfpglqggphnhaiagvavalkqamt
pefkeyqrqvvancralsaalvelgykivtggsdnhlilvdlrskgtdggraekvleacs
iacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkvahfihrgieltvqiqddtgp
ratlkefkeklagdekhqravralrqevesfaalfplpglpgf

SCOPe Domain Coordinates for d1rv4a_:

Click to download the PDB-style file with coordinates for d1rv4a_.
(The format of our PDB-style files is described here.)

Timeline for d1rv4a_: