Lineage for d1rtta_ (1rtt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856771Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
    Pfam PF03358
  6. 2856780Protein Hypothetical protein PA1204 [110475] (1 species)
  7. 2856781Species Pseudomonas aeruginosa [TaxId:287] [110476] (2 PDB entries)
    Uniprot Q9I4D4 5-167
  8. 2856782Domain d1rtta_: 1rtt A: [105098]
    complexed with so4

Details for d1rtta_

PDB Entry: 1rtt (more details), 1.28 Å

PDB Description: crystal structure determination of a putative nadh-dependent reductase using sulfur anomalous signal
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1rtta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]}
ikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfppaverf
reqiraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagrfgtara
qyhlrqtlvfldvhplnkpevmissaqnafdaqgrllddkareliqqqlqalql

SCOPe Domain Coordinates for d1rtta_:

Click to download the PDB-style file with coordinates for d1rtta_.
(The format of our PDB-style files is described here.)

Timeline for d1rtta_: