![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins) Pfam PF03358 |
![]() | Protein Hypothetical protein PA1204 [110475] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [110476] (2 PDB entries) Uniprot Q9I4D4 5-167 |
![]() | Domain d1rtta_: 1rtt A: [105098] complexed with so4 |
PDB Entry: 1rtt (more details), 1.28 Å
SCOPe Domain Sequences for d1rtta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]} ikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfppaverf reqiraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagrfgtara qyhlrqtlvfldvhplnkpevmissaqnafdaqgrllddkareliqqqlqalql
Timeline for d1rtta_: