Lineage for d1rteb_ (1rte B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530469Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
    lack the first helix (A)
  6. 530470Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 530484Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (4 PDB entries)
  8. 530488Domain d1rteb_: 1rte B: [105097]
    complexed with cyn, hem, so4

Details for d1rteb_

PDB Entry: 1rte (more details), 2 Å

PDB Description: X-ray Structure of Cyanide Derivative of Truncated Hemoglobin N (trHbN) from Mycobacterium Tuberculosis

SCOP Domain Sequences for d1rteb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rteb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvtsg

SCOP Domain Coordinates for d1rteb_:

Click to download the PDB-style file with coordinates for d1rteb_.
(The format of our PDB-style files is described here.)

Timeline for d1rteb_: