Lineage for d1rt8a_ (1rt8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995978Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1995979Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1995980Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 protein domains)
    Pfam PF00307
  6. 1996008Protein Fimbrin (Plastin), actin-crosslinking domain [47580] (3 species)
    duplication: tandem repeat of four CH domains
  7. 1996009Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [109828] (1 PDB entry)
    Uniprot O59945 108-614
  8. 1996010Domain d1rt8a_: 1rt8 A: [105095]
    complexed with so4

Details for d1rt8a_

PDB Entry: 1rt8 (more details), 2 Å

PDB Description: crystal structure of the actin-crosslinking core of schizosaccharomyces pombe fimbrin
PDB Compounds: (A:) fimbrin

SCOPe Domain Sequences for d1rt8a_:

Sequence, based on SEQRES records: (download)

>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ineeerrefikhinsvlagdpdvgsrvpintetfeffdqckdglilsklindsvpdtide
rvlnkqrnnkpldnfkciennnvvinsakamggisitnigagdilegrehlilglvwqii
rrgllgkiditlhpelyrlleedetldqflrlppekillrwfnyhlkaanwprtvsnfsk
dvsdgenytvllnqlapelcsraplqttdvlqraeqvlqnaekldcrkyltptamvagnp
klnlafvahlfnthpgleplneeekpeiepfdaegerearvftlwlnsldvtpsihdffn
nlrdglillqaydkitpntvnwkkvnkapasgdemmrfkavencnyavdlgknqgfslvg
iqgaditdgsrtltlalvwqmmrmnitktlhslsrggktlsdsdmvawansmaakggkgs
qirsfrdpsistgvfvldvlhgikseyvdynlvtdgsteelaiqnarlaisiarklgavi
filpedivavrprlvlhfigslmav

Sequence, based on observed residues (ATOM records): (download)

>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ineeerrefikhinsvlagdpdvgsrvpintetfeffdqckdglilsklindsvpdtide
rvlnkqrpldnfkciennnvvinsakamggisitnigagdilegrehlilglvwqiirrg
llgkitldqflrlppekillrwfnyhlkaanwprtvsnfskdvsdgenytvllnqlapel
csraplqttdvlqraeqvlqnaekldcrkyltptamvagnpklnlafvahlfnthpglep
aegerearvftlwlnsldvtpsihdffnnlrdglillqaydkitpntvnwkkvnkapasg
demmrfkavencnyavdlgknqgfslvgiqgaditdgsrtltlalvwqmmrmnitktlhs
tlsdsdmvawansmaakggkgsqirsfrdpsistgvfvldvlhgikseyvdynlvtdgst
eelaiqnarlaisiarklgavifilpedivavrprlvlhfigslmav

SCOPe Domain Coordinates for d1rt8a_:

Click to download the PDB-style file with coordinates for d1rt8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rt8a_: